Abnova™ Human ESR1 Partial ORF (NP_000116.2, 41 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-943-624	25 ug
89-943-623	10 ug

Catalog No. 89-943-624 Supplier Abnova™ Supplier No. H00002099Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters. [provided by RefSeq]

Sequence: EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT

Specifications

• Accession Number: NP_000116.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 2099
• Molecular Weight (g/mol): 36.63kDa
• Name: ESR1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp686N23123/ER/ESR/ESRA/Era/NR3A1
• Common Name: ESR1
• Gene Symbol: ESR1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid