Abnova™ Human F3 (NP_001984.1, 33 a.a. - 251 a.a.) Partial Recombinant Protein

Catalog No.	Quantity
89-943-818	10 μg

Catalog No. 89-943-818 Supplier Abnova™ Supplier No. P3830

Description

Used for Dot, ELISA, IHC, SDS-PAGE, WB

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq]

Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Specifications

• Accession Number: NP_001984.1
• For Use With (Application): Dot Blot, ELISA, Immunohistochemistry, SDS-PAGE, Western Blot
• Formulation: Liquid
• Gene ID (Entrez): 2152
• Name: F3 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 10% SDS-PAGE Result
• Quantity: 10 μg
• Immunogen: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
• Storage Requirements: Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CD142/TF/TFA
• Common Name: F3
• Gene Symbol: F3
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE