Learn More
Abnova™ Human FCGR2A Full-length ORF (AAH20823.1) Recombinant Protein without tag
Shop All Abnova Corporation ProductsDescription
This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Specifications
Specifications
| Accession Number | AAH20823.1 |
| For Use With (Application) | Antibody Production, Compound Screening, Functional Study |
| Formulation | Liquid |
| Gene ID (Entrez) | 2212 |
| Molecular Weight (g/mol) | 34.9kDa |
| Name | FCGR2A (Human) Recombinant Protein |
| Quantity | 10 μg |
| Immunogen | MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Regulatory Status | RUO |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.