Learn More
Description
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq]
Specifications
Specifications
| Accession Number | P09038 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 2247 |
| Molecular Weight (g/mol) | 16.5kDa |
| Name | FGF2 (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Quality Control Testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quantity | 50 μg |
| Immunogen | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.