Abnova™ Human FGF4 (P08620) Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P4384

Catalog No. 89-944-478

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq]

Sequence: MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Specifications

• Accession Number: P08620
• Formulation: Lyophilized
• Molecular Weight (g/mol): 19kDa
• Preparation Method: Escherichia coli expression system
• Immunogen: MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
• Regulatory Status: RUO
• Gene Alias: HBGF-4/HST/HST-1/HSTF1/K-FGF/KFGF
• Gene Symbol: FGF4
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 2249
• Name: FGF4 (Human) Recombinant Protein
• Quantity: 25 ug
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1 EU/μg
• Common Name: FGF4
• Biological Activity: The activity is determined by the ability to induce the proliferation of mouse NR6R-3T3 fibroblasts. The expected ED50 for this effect is less than 0.1ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system