Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89944605

Abnova™ Human FKBP2 (NP_001128680, 22 a.a. - 142 a.a.) Partial Recombinant Protein

Catalog No. 89944605 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-944-605 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-944-605 Supplier Abnova™ Supplier No. P3503
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Sequence: MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Specifications

Accession Number NP_001128680
Concentration 1 mg/mL
For Use With (Application) Functional Study, SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 2286
Molecular Weight (g/mol) 13.4kDa
Name FKBP2 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Purification Method Conventional Chromatography
Quality Control Testing Loading 3 ug protein in 15% SDS-PAGE
Quantity 50 μg
Immunogen MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Storage Requirements Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias FKBP-13/PPIase
Common Name FKBP2
Gene Symbol FKBP2
Biological Activity Specific activity is > 270nmoles/min/μg, and is defined as the amount of enzyme that cleaves 1μmole of suc-AAPF-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >90% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.