Abnova™ Human FKHL18 Partial ORF (NP_004109.1, 1 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-944-627	25 ug
89-944-626	10 ug

Catalog No. 89-944-627 Supplier Abnova™ Supplier No. H00002307Q01L

Description

Used for AP, Array, ELISA, WB-Re

The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq]

Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLD

Specifications

• Accession Number: NP_004109.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 2307
• Molecular Weight (g/mol): 36.19kDa
• Name: FKHL18 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FKHL18/FREAC10/MGC4544
• Common Name: FOXS1
• Gene Symbol: FOXS1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid