Abnova™ Human FOXO1 Partial ORF (NP_002006.2, 452 a.a. - 555 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-945-084	25 ug
89-945-083	10 ug

Catalog No. 89-945-084 Supplier Abnova™ Supplier No. H00002308Q02L

Description

Used for AP, Array, ELISA, WB-Re

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq]

Sequence: MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL

Specifications

• Accession Number: NP_002006.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 2308
• Molecular Weight (g/mol): 37.07kDa
• Name: FOXO1 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Quantity: 25 ug
• Immunogen: MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FKH1/FKHR/FOXO1A
• Common Name: FOXO1
• Gene Symbol: FOXO1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid