Abnova™ Human FZD8 Partial ORF (NP_114072, 72 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-945-303	25 μg
89-945-302	10 μg

Catalog No. 89-945-303 Supplier Abnova™ Supplier No. H00008325Q01L

Description

Used for AP, Array, ELISA, WB-Re

This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. [provided by RefSeq]

Sequence: FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP

Specifications

• Accession Number: NP_114072
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 8325
• Molecular Weight (g/mol): 35.64kDa
• Name: FZD8 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FZ-8/hFZ8
• Common Name: FZD8
• Gene Symbol: FZD8
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid