Abnova™ Human GDF15 (D variant) (Q99988) Recombinant Protein

Catalog No.	Quantity
89-945-702	20 μg

Catalog No. 89-945-702 Supplier Abnova™ Supplier No. P4571

Description

Used for Func, SDS-PAGE

Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM]

Sequence: MARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Specifications

• Accession Number: Q99988
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 9518
• Molecular Weight (g/mol): 26.8kDa
• Name: GDF15 (D variant) (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 20 μg
• Immunogen: MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with 5 mM acetic acid, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: GDF-15/MIC-1/MIC1/NAG-1/PDF/PLAB/PTGFB
• Common Name: GDF15
• Gene Symbol: GDF15
• Biological Activity: The activity is determined by the inhibition of DU-145 cells and is typically 1-2μg/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized