Abnova™ Human GDF5 (P43026) Recombinant Protein

Catalog No.	Quantity
89-945-716	50 μg

Catalog No. 89-945-716 Supplier Abnova™ Supplier No. P4393

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Mutations in this gene are associated with acromesomelic dysplasia, Hunter-Thompson type; brachydactyly, type C; and chondrodysplasia, Grebe type. These associations confirm that the gene product plays a role in skeletal development. [provided by RefSeq]

Sequence: APSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Specifications

• Accession Number: P43026
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 8200
• Molecular Weight (g/mol): 26.8kDa
• Name: GDF5 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quantity: 50 μg
• Immunogen: MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: BMP14/CDMP1/LAP4/SYNS2
• Common Name: GDF5
• Gene Symbol: GDF5
• Biological Activity: The activity is determined by the ability to induce alkaline phosphatase activity in ATDC5 cells. The expected ED50 for this effect is 8-12ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized