Abnova™ Human GLIPR1 Partial ORF (NP_006842, 23 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-945-973	25 μg
89-945-972	10 μg

Catalog No. 89-945-973 Supplier Abnova™ Supplier No. H00011010Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Sequence: NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN

Specifications

• Accession Number: NP_006842
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 11010
• Molecular Weight (g/mol): 34.21kDa
• Name: Human GLIPR1 Partial ORF (NP_006842, 23 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CRISP7, GLIPR, RTVP1
• Common Name: GLIPR1
• Gene Symbol: GLIPR1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid