Abnova™ Human GPAM Partial ORF (NP_065969, 749 a.a. - 828 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-946-327	10 μg
89-946-328	25 μg

Catalog No. 89-946-327 Supplier Abnova™ Supplier No. H00057678Q01S

Description

Used for AP, Array, ELISA, WB-Re

Glycerol-3-phosphate acyltransferase (GPAT; EC 2.3.1.15), which catalyzes the initial and committing step in glycerolipid biosynthesis, is predicted to play a pivotal role in the regulation of cellular triacylglycerol and phospholipid levels. Two mammalian forms of GPAT have been identified on the basis of localization to either the endoplasmic reticulum or mitochondria.[supplied by OMIM]

Sequence: PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL

Specifications

• Accession Number: NP_065969
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 57678
• Molecular Weight (g/mol): 34.54kDa
• Name: GPAM (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: GPAT1/KIAA1560/MGC26846/RP11-426E5.2
• Common Name: GPAM
• Gene Symbol: GPAM
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid