Invitrogen™ Human GPR132 (aa 8-43) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95329	100 μL

Catalog No. RP95329 Supplier Invitrogen™ Supplier No. RP95329

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPCR G2A is a G-protein linked receptor for lysophosphatidylcholine (LPC). It may play a role as a sensor of LPC levels at sites of inflammation to limit tissue-infiltrating-cells and progression to overt autoimmune disease and functions at the G2/M checkpoint to delay mitosis. It also may serve as a mechanism for T and B cells, and other cell types, to slow their proliferation and repair damaged DNA. It is highly expressed in macrophages and hematopoietic tissues rich in lymphocytes, like spleen and thymus, but weakly expressed in heart and lung. In atherosclerotic plaques, expression was observed around the lipid core and at the shoulder region. It is induced by DNA-damaging agents.

Specifications

• Accession Number: Q9UNW8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29933
• Name: Human GPR132 (aa 8-43) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G protein-coupled receptor 132; G protein-coupled receptor G2A; G2 accumulation protein; G2a; GPR132; MGC99642; Probable G-protein coupled receptor 132
• Common Name: GPR132
• Gene Symbol: GPR132
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining