Abnova™ Human ID4 Partial ORF (NP_001537, 60 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-948-223	25 ug
89-948-222	10 ug

Catalog No. 89-948-223 Supplier Abnova™ Supplier No. H00003400Q01L

Description

Used for AP, Array, ELISA, WB-Re

Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM]

Sequence: PALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALET

Specifications

• Accession Number: NP_001537
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3400
• Molecular Weight (g/mol): 31.35kDa
• Name: ID4 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: PALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALET
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: IDB4/bHLHb27
• Common Name: ID4
• Gene Symbol: ID4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid