Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89948380

Abnova™ Human IFNB1 (P01574, 22 a.a. - 187 a.a.) Partial Recombinant Protein expressed in CHO cells

Catalog No. 89948380 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-948-380 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-948-380 Supplier Abnova™ Supplier No. P3623
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Specifications

Accession Number P01574
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 3456
Molecular Weight (g/mol) 19kDa
Name IFNB1 (Human) Recombinant Protein
Preparation Method Mammalian cell (CHO) expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 20 μg
Immunogen MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias IFB/IFF/IFNB/MGC96956
Common Name IFNB1
Gene Symbol IFNB1
Biological Activity The activity was determined by the viral resistance assay of Human WISH cells was found to be in the range of 3 x 108 IU/mg.
Species Human
Recombinant Recombinant
Protein Tag None
Expression System Mammalian cell (CHO) expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.