Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IFNB1 (P01574, 22 a.a. - 187 a.a.) Partial Recombinant Protein expressed in CHO cells

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P3623

Catalog No. 89-948-380


Add to cart

Description

Description

Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Specifications

Specifications

P01574
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
19kDa
Mammalian cell (CHO) expression system
>90% by SDS-PAGE and HPLC
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
RUO
IFB|IFF|IFNB|MGC96956
IFNB1
Hamster
None
Mammalian cell (CHO) expression system
Lyophilized
3456
IFNB1 (Human) Recombinant Protein
Ion exchange column and HPLC reverse phase column
20 ug
Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg (1 EU/μg)
IFNB1
The activity was determined by the viral resistance assay of Human WISH cells was found to be in the range of 3 x 108 IU/mg.
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit