Abnova™ Human IFNG (P01579) Recombinant Protein

Catalog No.	Quantity
89-948-394	100 μg

Catalog No. 89-948-394 Supplier Abnova™ Supplier No. P4400

Description

Used for Func, SDS-PAGE

Interferon-gamma (IFNG), or type II interferon, is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Aberrant IFNG expression is associated with a number of autoinflammatory and autoimmune diseases. The importance of IFNG in the immune system stems in part from its ability to inhibit viral replication directly, but most importantly derives from its immunostimulatory and immunomodulatory effects. IFNG is produced predominantly by natural killer (NK) and natural killer T (NKT) cells as part of the innate immune response, and by CD4 (MIM 186940) and CD8 (see MIM 186910) cytotoxic T lymphocyte (CTL) effector T cells once antigen-specific immunity develops (Schoenborn and Wilson, 2007 [PubMed 17981204]).[supplied by OMIM]

Sequence: MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ

Specifications

• Accession Number: P01579
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 3458
• Molecular Weight (g/mol): 16.88kDa
• Name: IFNG (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quantity: 100 μg
• Immunogen: MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: IFG/IFI
• Common Name: IFNG
• Gene Symbol: IFNG
• Biological Activity: The activity is determined by the viral resistance assay using L929 cells is 5.8-8.8x10⁷ Units/mg. The expected ED50 for this effect is 0.01-0.02ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized