Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IGF2 Full-length ORF (P09565, 1 a.a. - 113 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89948467 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 ug
25 ug
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-948-467 10 ug
89-948-468 25 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-948-467 Supplier Abnova™ Supplier No. H00003481P02S
Add to Cart
Add to Cart

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq]

Sequence: MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA

Specifications

Accession Number P09565
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 3481
Molecular Weight (g/mol) 38.50kDa
Name IGF2 (Human) Recombinant Protein (P02)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 ug
Immunogen MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias C11orf43/FLJ22066/FLJ44734/INSIGF/pp9974
Common Name IGF2
Gene Symbol IGF2
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.