Abnova™ Human IGF2 Full-length ORF (P09565, 1 a.a. - 113 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-948-468	25 ug
89-948-467	10 ug

Catalog No. 89-948-468 Supplier Abnova™ Supplier No. H00003481P02L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq]

Sequence: MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA

Specifications

• Accession Number: P09565
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3481
• Molecular Weight (g/mol): 38.50kDa
• Name: IGF2 (Human) Recombinant Protein (P02)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: C11orf43/FLJ22066/FLJ44734/INSIGF/pp9974
• Common Name: IGF2
• Gene Symbol: IGF2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid