Abnova™ Human IGF2R Partial ORF (NP_000867, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-948-473	25 ug
89-948-472	10 ug

Catalog No. 89-948-473 Supplier Abnova™ Supplier No. H00003482Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. In mice, the homologous gene is expressed only from the maternal chromosome. [provided by RefSeq]

Sequence: GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRD

Specifications

• Accession Number: NP_000867
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3482
• Molecular Weight (g/mol): 36.74kDa
• Name: IGF2R (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CD222/CIMPR/M6P-R/MPR1/MPRI
• Common Name: IGF2R
• Gene Symbol: IGF2R
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid