Abnova™ Human IL10RB Full-length ORF (NP_000619.3) Recombinant Protein without tag

Catalog No.	Quantity
89-948-607	10 μg

Catalog No. 89-948-607 Supplier Abnova™ Supplier No. H00003588G01

Description

Used for AP, Func, Screening

The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. [provided by RefSeq]

Sequence: MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS

Specifications

• Accession Number: NP_000619.3
• For Use With (Application): Antibody Production, Compound Screening, Functional Study
• Formulation: Liquid
• Gene ID (Entrez): 3588
• Molecular Weight (g/mol): 37kDa
• Name: IL10RB (Human) Recombinant Protein
• Quantity: 10 μg
• Immunogen: MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CDW210B/CRF2-4/CRFB4/D21S58/D21S66/IL-10R2
• Common Name: IL10RB
• Gene Symbol: IL10RB
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: wheat germ expression system with proprietary liposome technology
• Form: Liquid