Abnova™ Human IL12A (NP_000873.2, 57 a.a. - 253 a.a.) Partial Recombinant Protein

Used for SDS-PAGE

Supplier:  Abnova™ P3812

Catalog No. 89-948-619

Description

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq]

Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Specifications

• Accession Number: NP_000873.2
• Formulation: Liquid
• Name: IL12A (Human) Recombinant Protein
• Quality Control Testing: 10% SDS-PAGE Result
• Immunogen: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
• Regulatory Status: RUO
• Common Name: IL12A
• Species: E. coli
• Protein Tag: None
• Form: Liquid

• For Use With (Application): SDS-PAGE
• Gene ID (Entrez): 3592
• Preparation Method: Escherichia coli expression system
• Quantity: 10 ug
• Storage Requirements: Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CLMF/IL-12A/NFSK/NKSF1/P35
• Gene Symbol: IL12A
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >95% by SDS-PAGE