Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL13 (P35225) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6089

Catalog No. 89-948-641


Add to cart

Description

Description

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq]

Sequence: MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Specifications

Specifications

P35225
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
IL13 (Human) Recombinant Protein
0.98
MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
RUO
ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600
IL13
Human ;Human
Yes
E. coli expression system
Lyophilized
3596
E. coli expression system
10 ug
Store at -20°C. Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex. Note: Allow the reconstituted vial to sit at 4°C for more than 2 hours before use. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
<0.1ng/μg (<1 EU/μg)
IL13
This IL-13 analog, with a substitution of Q for R at position 112, measured by the in vitro dose dependent activation of STAT6 and IL-13 dependent gene induction in transfected A201.1 cells. This analog has also been shown to exhibit increased in vivo activity compared to wild type IL-13, as measured by the induction of airway hyper-responsiveness.
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit