Abnova™ Human IL13 (P35225) Partial Recombinant Protein

Catalog No.	Quantity
89-948-641	10 μg

Catalog No. 89-948-641 Supplier Abnova™ Supplier No. P6089

Description

Used for Func, SDS-PAGE

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq]

Sequence: MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

Specifications

• Accession Number: P35225
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 3596
• Name: IL13 (Human) Recombinant Protein
• Preparation Method: E. coli expression system
• Quantity: 10 μg
• Immunogen: MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
• Storage Requirements: Store at -20°C. Reconstitute in water to a concentration of 0.5-1.0 mg/mL. Do not vortex. Note: Allow the reconstituted vial to sit at 4°C for more than 2 hours before use. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (<1 EU/μg)
• Gene Alias: ALRH/BHR1/IL-13/MGC116786/MGC116788/MGC116789/P600
• Common Name: IL13
• Gene Symbol: IL13
• Biological Activity: This IL-13 analog, with a substitution of Q for R at position 112, measured by the in vitro dose dependent activation of STAT6 and IL-13 dependent gene induction in transfected A201.1 cells. This analog has also been shown to exhibit increased in vivo activity compared to wild type IL-13, as measured by the induction of airway hyper-responsiveness.
• Cross Reactivity: Human ;Human
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: E. coli expression system
• Form: Lyophilized
• Purity or Quality Grade: 0.98