Abnova™ Human IL15 (NP_751914, 49 a.a. - 162 a.a.) Partial Recombinant Protein with His tag

Catalog No.	Quantity
89-948-655	100 μg

Catalog No. 89-948-655 Supplier Abnova™ Supplier No. P3462

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq]

Sequence: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH

Specifications

• Accession Number: NP_751914
• Concentration: 1 mg/mL
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 3600
• Molecular Weight (g/mol): 13.9kDa
• Name: IL15 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <1.0 EU/μg of protein (determined by LAL method)
• Gene Alias: IL-15/MGC9721
• Common Name: IL15
• Gene Symbol: IL15
• Biological Activity: Measured in a cell proliferation assay using CTLL2 mouse cytotoxic T cells. The ED50 for this effect is < 2.5ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE