Abnova™ Human IL17C Full-length ORF (NP_037410.1, 1 a.a. - 197 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-948-689	10 μg
89-948-690	25 μg

Catalog No. 89-948-689 Supplier Abnova™ Supplier No. H00027189P01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq]

Sequence: MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Specifications

• Accession Number: NP_037410.1
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 27189
• Molecular Weight (g/mol): 48.2kDa
• Name: Human IL17C Full-length ORF (NP_037410.1, 1 a.a. - 197 a.a.) Recombinant Protein with GST-tag at N-terminal
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CX2, IL-17C, IL-21, MGC126884, MGC138401
• Common Name: IL17C
• Gene Symbol: IL17C
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid