Abnova™ Human IL3 (P08700, 20 a.a. - 152 a.a.) Partial Recombinant Protein

Catalog No.	Quantity
89-948-874	10 μg

Catalog No. 89-948-874 Supplier Abnova™ Supplier No. P3636

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq]

Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Specifications

• Accession Number: P08700
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 3562
• Molecular Weight (g/mol): 15kDa
• Name: IL3 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 μg
• Immunogen: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Gene Alias: IL-3/MCGF/MGC79398/MGC79399/MULTI-CSF
• Common Name: IL3
• Gene Symbol: IL3
• Biological Activity: The ED50 was determined by the dose-dependent proliferation of Human TF-1 cells was found less than 0.1ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC