Abnova™ Human IL33 (O95760, 112 a.a. - 270 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P3638

Catalog No. 89-948-895

Description

Sequence: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Specifications

• Accession Number: O95760
• For Use With (Application): Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
• Formulation: Lyophilized
• Molecular Weight: 18kDa
• Preparation Method: Escherichia coli expression system
• Purity: >90% by SDS-PAGE and HPLC
• Immunogen: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Regulatory Status: RUO
• Gene Alias: C9orf26|DKFZp586H0523|DVS27|NF-HEV|NFEHEV|RP11-575C20.2
• Gene Symbol: IL33
• Host Species: Escherichia coli
• Protein Tag: None

• Expression System: Escherichia coli expression system
• Format: Lyophilized
• Gene ID (Entrez): 90865
• Name: IL33 (Human) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: IL33
• Biological Activity: The ED50 was determined by the dose-dependent proliferation of murine D10S cells is ≤ 0.03ng/mL.
• Recombinant: Yes