Abnova™ Human IL6 (P05231) Recombinant Protein

Catalog No.	Quantity
89-948-936	20 μg

Catalog No. 89-948-936 Supplier Abnova™ Supplier No. P4416

Description

Used for Func, SDS-PAGE

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq]

Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Specifications

• Accession Number: P05231
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 3569
• Molecular Weight (g/mol): 21kDa
• Name: IL6 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 20 μg
• Immunogen: MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with 10 mM HCl, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: BSF2/HGF/HSF/IFNB2/IL-6
• Common Name: IL6
• Gene Symbol: IL6
• Biological Activity: The activity is determined by the dose-dependant stimulation of mouse 7TD1 cells and is typcially less than 1ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized