Abnova™ Human JUND Partial ORF (NP_005345, 258 a.a. - 347 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-949-468	2 μg

Catalog No. 89-949-468 Supplier Abnova™ Supplier No. H00003727Q01

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. It has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternate translation initiation site usage results in the production of different isoforms. [provided by RefSeq]

Sequence: LSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

Specifications

• Accession Number: NP_005345
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3727
• Molecular Weight (g/mol): 35.64kDa
• Name: JUND (Human) Recombinant Protein (Q01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 2 μg
• Immunogen: LSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: AP-1
• Common Name: JUND
• Gene Symbol: JUND
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid