Abnova™ Human KPNA2 Partial ORF (NP_002257, 420 a.a. - 528 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-950-166	10 ug
89-950-167	25 ug

Catalog No. 89-950-166 Supplier Abnova™ Supplier No. H00003838Q01S

Description

Used for AP, Array, ELISA, WB-Re

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination [provided by RefSeq]

Sequence: GIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFN

Specifications

• Accession Number: NP_002257
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3838
• Molecular Weight (g/mol): 37.73kDa
• Name: KPNA2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: GIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFN
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: IPOA1/QIP2/RCH1/SRP1alpha
• Common Name: KPNA2
• Gene Symbol: KPNA2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid