Abnova™ Human KRAS Partial ORF (NP_004976, 16 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-950-178	10 ug
89-950-179	25 ug

Catalog No. 89-950-178 Supplier Abnova™ Supplier No. H00003845Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq]

Sequence: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

Specifications

• Accession Number: NP_004976
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 3845
• Molecular Weight (g/mol): 37.84kDa
• Name: KRAS (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: C-K-RAS/K-RAS2A/K-RAS2B/K-RAS4A/K-RAS4B/KI-RAS/KRAS1/KRAS2/NS3/RASK2
• Common Name: KRAS
• Gene Symbol: KRAS
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid