Abnova™ Human KRTHA6 Partial ORF (NP_003762.1, 368 a.a. - 467 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-950-294	25 μg
89-950-293	10 μg

Catalog No. 89-950-294 Supplier Abnova™ Supplier No. H00008689Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. [provided by RefSeq]

Sequence: DLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL

Specifications

• Accession Number: NP_003762.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 8689
• Molecular Weight (g/mol): 36.74kDa
• Name: KRTHA6 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: DLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: HA6/KRTHA6/hHa6
• Common Name: KRT36
• Gene Symbol: KRT36
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid