Abnova™ Human LIF (P15018, 23 a.a. - 202 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P3646

Catalog No. 89-950-655

Description

The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. [provided by RefSeq]

Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Specifications

• Accession Number: P15018
• For Use With (Application): Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
• Formulation: Lyophilized
• Molecular Weight: 20kDa
• Preparation Method: Escherichia coli expression system
• Purity: >90% by SDS-PAGE and HPLC
• Immunogen: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
• Regulatory Status: RUO
• Gene Alias: CDF|DIA|HILDA
• Gene Symbol: LIF
• Host Species: Escherichia coli
• Protein Tag: None

• Expression System: Escherichia coli expression system
• Format: Lyophilized
• Gene ID (Entrez): 3976
• Name: LIF (Human) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: LIF
• Biological Activity: The ED50 was determined by the dose-dependent differentiation of M1 myeloid leukemic cells was found to be in the range of 0.01ng/mL.
• Recombinant: Yes