Abnova™ Human MAG Partial ORF (NP_002352, 119 a.a. - 208 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-951-415	10 ug
89-951-416	25 ug

Catalog No. 89-951-415 Supplier Abnova™ Supplier No. H00004099Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Two alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq]

Sequence: GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR

Specifications

• Accession Number: NP_002352
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4099
• Molecular Weight (g/mol): 35.64kDa
• Name: MAG (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: GMA/S-MAG/SIGLEC-4A/SIGLEC4A
• Common Name: MAG
• Gene Symbol: MAG
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid