Abnova™ Human MAPK3 Partial ORF (AAH13992, 279 a.a. - 379 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-951-739	10 ug
89-951-740	25 ug

Catalog No. 89-951-739 Supplier Abnova™ Supplier No. H00005595Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq]

Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

Specifications

• Accession Number: AAH13992
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5595
• Molecular Weight (g/mol): 36.74kDa
• Name: MAPK3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ERK1/HS44KDAP/HUMKER1A/MGC20180/P44ERK1/P44MAPK/PRKM3
• Common Name: MAPK3
• Gene Symbol: MAPK3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid