Abnova™ Human MNAT1 Partial ORF (NP_002422, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-952-714	25 ug
89-952-713	10 ug

Catalog No. 89-952-714 Supplier Abnova™ Supplier No. H00004331Q01L

Description

Used for AP, Array, ELISA, WB-Re

Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.[supplied by OMIM]

Sequence: MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLT

Specifications

• Accession Number: NP_002422
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4331
• Molecular Weight (g/mol): 37.84kDa
• Name: MNAT1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MAT1/RNF66/TFB3
• Common Name: MNAT1
• Gene Symbol: MNAT1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid