Abnova™ Human MUC5B Partial ORF (XP_039877.9, 4186 a.a. - 4295 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-953-244	25 μg
89-953-243	10 μg

Catalog No. 89-953-244 Supplier Abnova™ Supplier No. H00727897Q01L

Description

Used for AP, Array, ELISA, WB-Re

Mucins are high molecular mass, highly glycosylated macromolecules that are the major components of mucus secretions. MUC5B is a salivary mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva. It is composed of 14.9% protein, 78.1% carbohydrate, and 7% sulfate (Troxler et al., 1995 [PubMed 8554565]).[supplied by OMIM]

Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Specifications

• Accession Number: XP_039877.9
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 727897
• Molecular Weight (g/mol): 37.84kDa
• Name: MUC5B (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MG1/MUC5/MUC9
• Common Name: MUC5B
• Gene Symbol: MUC5B
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid