Abnova™ Human MYH9 Partial ORF (NP_002464.1, 1747 a.a. - 1852 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-953-353	25 ug
89-953-352	10 ug

Catalog No. 89-953-353 Supplier Abnova™ Supplier No. H00004627Q02L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq]

Sequence: LINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVD

Specifications

• Accession Number: NP_002464.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4627
• Molecular Weight (g/mol): 37.4kDa
• Name: MYH9 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: LINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DFNA17/EPSTS/FTNS/MGC104539/MHA/NMHC-II-A/NMMHCA
• Common Name: MYH9
• Gene Symbol: MYH9
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid