Abnova™ Human MYL3 Partial ORF (NP_000249.1, 34 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-953-360	25 ug
89-953-359	10 ug

Catalog No. 89-953-360 Supplier Abnova™ Supplier No. H00004634Q01L

Description

Used for AP, Array, ELISA, WB-Re

MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq]

Sequence: EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNT

Specifications

• Accession Number: NP_000249.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4634
• Molecular Weight (g/mol): 33.77kDa
• Name: MYL3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CMH8/MLC1SB/MLC1V/VLC1
• Common Name: MYL3
• Gene Symbol: MYL3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid