Abnova™ Human NCOA3 Partial ORF (NP_006525, 251 a.a. - 360 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-953-736	10 μg
89-953-737	25 μg

Catalog No. 89-953-736 Supplier Abnova™ Supplier No. H00008202Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein. [provided by RefSeq]

Sequence: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR

Specifications

• Accession Number: NP_006525
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 8202
• Molecular Weight (g/mol): 37.84kDa
• Name: NCOA3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACTR/AIB-1/AIB1/CAGH16/CTG26/KAT13B/MGC141848/RAC3/SRC3/TNRC14/TNRC16/TRAM-1/bHLHe42/pCIP
• Common Name: NCOA3
• Gene Symbol: NCOA3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid