Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 89954126

Abnova™ Human NGF (P01138, 122 a.a. - 241 a.a.) Partial Recombinant Protein expressed in CHO cells

Catalog No. 89954126 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
20 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-954-126 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-954-126 Supplier Abnova™ Supplier No. P3657
Add to Cart
Add to Cart

Description

Used for Func, SDS-PAGE

This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq]

Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Specifications

Accession Number P01138
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 4803
Molecular Weight (g/mol) 27kDa
Name NGF (Human) Recombinant Protein
Preparation Method Mammalian cell (CHO) expression system
Purification Method Ion exchange column and HPLC reverse phase column
Quantity 20 μg
Immunogen SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Storage Requirements Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1ng/μg (1 EU/μg)
Gene Alias Beta-NGF/HSAN5/MGC161426/MGC161428/NGFB
Common Name NGF
Gene Symbol NGF
Biological Activity The ED50 was determined by the determined by its ability to proliferate TF-1 cells and was found to be in the range of 0.5ng/mL.
Species Human
Recombinant Recombinant
Protein Tag None
Expression System Mammalian cell (CHO) expression system
Form Lyophilized
Purity or Quality Grade >90% by SDS-PAGE and HPLC
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.