Invitrogen™ Human NUP50 (aa 5-45) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104853	100 μL

Catalog No. RP104853 Supplier Invitrogen™ Supplier No. RP104853

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83907 (PA5-83907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9UKX7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10762
• Name: Human NUP50 (aa 5-45) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700030K07Rik; 50 kDa nucleoporin; AI413123; CTA-268H5.7; DKFZP564A043; MGC39961; Npap60; NPAP60L; nuclear pore associated protein; nuclear pore associated protein 60 kDa; nuclear pore complex protein Nup50; nuclear pore complex protein Nup50; LOW QUALITY PROTEIN: nuclear pore complex protein Nup50; nuclear pore complex protein nup50-like protein; Nuclear pore-associated protein 60 kDa-like; nuclear pore-associated protein 60 L; nucleoporin 50; nucleoporin 50 kDa; Nucleoporin 50 kDa-like protein; nucleoporin 50 kD; nucleoporin 50 kDa; nucleoporin Nup50; nucleoprotein 50; Nucleoprotein 50 kD; Nup50; NUP50 protein; OTTHUMP00000199530; PRO1146; Rtp60; Unknown (protein for MGC:134469)
• Common Name: NUP50
• Gene Symbol: NUP50
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining