Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IC1419A

Human Osteocalcin APC-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Catalog No. IC1419A
Change view
Click to view available options
Quantity:
100 Tests
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
IC1419A 100 Tests
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. IC1419A Supplier R&D Systems Supplier No. IC1419A
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody has been used in 2 publications

Osteocalcin Monoclonal specifically detects Osteocalcin in Human samples. It is validated for Intracellular Staining by Flow Cytometry.

Specifications

Antigen Osteocalcin
Applications Flow Cytometry
Classification Monoclonal
Clone 190125
Conjugate APC
Dilution Intracellular Staining by Flow Cytometry 10 uL/10^6 cells
Formulation Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
Gene Accession No. P02818
Gene Alias BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
Gene Symbols BGLAP
Host Species Mouse
Immunogen Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
Purification Method Protein A or G purified from hybridoma culture supernatant
Quantity 100 Tests
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 632
Test Specificity Detects human Osteocalcin in direct ELISAs.
Target Species Human
Content And Storage Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.