Abnova™ Human OVGP1 Partial ORF (NP_002548.3, 579 a.a. - 677 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-955-419	10 ug
89-955-420	25 ug

Catalog No. 89-955-419 Supplier Abnova™ Supplier No. H00005016Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene families. Regulation of expression may be estrogen-dependent. Gene expression and protein secretion occur during late follicular development through early cleavage-stage embryonic development. The protein is secreted from non-ciliated oviductal epithelial cells and associates with ovulated oocytes, blastomeres, and spermatozoan acrosomal regions. [provided by RefSeq]

Sequence: RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE

Specifications

• Accession Number: NP_002548.3
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5016
• Molecular Weight (g/mol): 36.63kDa
• Name: OVGP1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CHIT5/EGP/MUC9/OGP
• Common Name: OVGP1
• Gene Symbol: OVGP1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid