Abnova™ Human PHACTR3 Partial ORF (NP_542403.1, 92 a.a. - 179 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-956-643	10 μg
89-956-644	25 μg

Catalog No. 89-956-643 Supplier Abnova™ Supplier No. H00116154Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD

Specifications

• Accession Number: NP_542403.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 116154
• Molecular Weight (g/mol): 35.42kDa
• Name: PHACTR3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: C20orf101/H17739/MGC117178/SCAPIN1/SCAPININ
• Common Name: PHACTR3
• Gene Symbol: PHACTR3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid