Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human PIGW Partial ORF (NP_848612.2, 399 a.a. - 447 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human PIGW Partial ORF (NP_848612.2, 399 a.a. - 447 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89956930 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-956-930 10 μg
89-956-931 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-956-930 Supplier Abnova™ Supplier No. H00284098Q01S

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Used for AP, Array, ELISA, WB-Re

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM]

Sequence: KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK

Specifications

Accession Number NP_848612.2
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 284098
Molecular Weight (g/mol) 31.13kDa
Name PIGW (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 10 μg
Immunogen KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias FLJ37433/Gwt1
Common Name PIGW
Gene Symbol PIGW
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.