Abnova™ Human PKIB Full-length ORF (NP_115860.1, 1 a.a. - 78 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-106	10 ug
89-957-107	25 ug

Catalog No. 89-957-106 Supplier Abnova™ Supplier No. H00005570P01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the cAMP-dependent protein kinase inhibitor family. Studies of a similar protein in rat suggest that this protein may interact with the catalytic subunit of cAMP-dependent protein kinase and act as a competitive inhibitor. At least three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK

Specifications

• Accession Number: NP_115860.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5570
• Molecular Weight (g/mol): 34.9kDa
• Name: PKIB (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ23817/PRKACN2
• Common Name: PKIB
• Gene Symbol: PKIB
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid