Abnova™ Human PLAUR Full-length ORF (AAH02788, 1 a.a. - 335 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-219	10μg
89-957-220	25μg

Catalog No. 89-957-219 Supplier Abnova™ Supplier No. H00005329P01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq]

Sequence: MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

Specifications

• Accession Number: AAH02788
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5329
• Molecular Weight (g/mol): 62.59kDa
• Name: Human PLAUR Full-length ORF (AAH02788, 1 a.a. - 335 a.a.) Recombinant Protein with GST-tag at N-terminal
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CD87, UPAR, URKR
• Common Name: PLAUR
• Gene Symbol: PLAUR
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid