Abnova™ Human PLN Partial ORF (AAH05269, 1 a.a. - 30 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-368	10 ug
89-957-369	25 ug

Catalog No. 89-957-368 Supplier Abnova™ Supplier No. H00005350Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure. [provided by RefSeq]

Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQN

Specifications

• Accession Number: AAH05269
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5350
• Molecular Weight (g/mol): 28.93kDa
• Name: PLN (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MEKVQYLTRSAIRRASTIEMPQQARQKLQN
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CMD1P/PLB
• Common Name: PLN
• Gene Symbol: PLN
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid