Abnova™ Human POLR2F Partial ORF (AAH03582, 28 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-575	10 ug
89-957-576	25 ug

Catalog No. 89-957-575 Supplier Abnova™ Supplier No. H00005435Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes, that is also shared by the other two DNA-directed RNA polymerases. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. [provided by RefSeq]

Sequence: AEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

Specifications

• Accession Number: AAH03582
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5435
• Molecular Weight (g/mol): 36.74kDa
• Name: POLR2F (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: AEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: HRBP14.4/POLRF/RPABC2/RPB14.4/RPB6
• Common Name: POLR2F
• Gene Symbol: POLR2F
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid